PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 163aa    MW: 18965.1 Da    PI: 9.3977
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1008genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.31.2e-1155108457
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                   +++rrk++NRe+A+rsR RKk  +e+L+  v  +  eN++Lk++l    +++ 
  Gh_A01G1008  55 ERKQRRKISNRESAKRSRWRKKRHLENLTSQVNRMNIENRRLKNRLHLVINQCH 108
                  589*****************************************9998888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.4E-1352116IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-1053107No hitNo description
PROSITE profilePS5021710.49654100IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.48E-1056110No hitNo description
PfamPF001701.1E-856107IPR004827Basic-leucine zipper domain
CDDcd147021.72E-1557108No hitNo description
PROSITE patternPS0003605974IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MFSAEEAVGS QLPAHESGFT PEELNELLSF FESNEPVSSN SSSENSSRAI FSPDERKQRR  60
KISNRESAKR SRWRKKRHLE NLTSQVNRMN IENRRLKNRL HLVINQCHVV WGENEQLRSE  120
SFALWAKLLD LYWTLATMQC NHDNSRHSLS CFNSNKLSSN SIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15876RRKISNRESAKRSRWRKKR
27396RKKRHLENLTSQVNRMNIENRRLK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012466633.12e-98PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0D2NMR02e-98A0A0D2NMR0_G
STRINGPOPTR_0014s01390.12e-44(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122322432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.18e-19basic leucine-zipper 5